PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN11087.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 296aa    MW: 31518.9 Da    PI: 6.7474
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN11087.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.14e-081155345
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45
                      W+ e d+ + +a + +  +   +W++I + ++ g+t +++k ++ 
       KHN11087.1 11 EWSREQDKAFENALATHLEDasdRWEKIVADVP-GKTIEEIKQHYE 55
                     7*****************99*************.**********95 PP

2Myb_DNA-binding422.2e-13122166347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT++E+ l++ +  ++G+g+W++I+r +  +Rt+ q+ s+ qky
       KHN11087.1 122 AWTEDEHRLFLLGLDKYGKGDWRSISRNFVVTRTPTQVASHAQKY 166
                      6*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512937.898762IPR017884SANT domain
SMARTSM007171.8E-7860IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.2E-41155IPR009057Homeodomain-like
SuperFamilySSF466891.66E-91165IPR009057Homeodomain-like
CDDcd001671.36E-71158No hitNo description
PfamPF002495.2E-61155IPR001005SANT/Myb domain
PROSITE profilePS5129417.581114171IPR017930Myb domain
SuperFamilySSF466891.17E-16117172IPR009057Homeodomain-like
SMARTSM007173.2E-10119169IPR001005SANT/Myb domain
TIGRFAMsTIGR015572.6E-17119169IPR006447Myb domain, plants
CDDcd001678.46E-10122167No hitNo description
Gene3DG3DSA:1.10.10.601.4E-10122165IPR009057Homeodomain-like
PfamPF002492.7E-11122166IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MTVDEVDSSS EWSREQDKAF ENALATHLED ASDRWEKIVA DVPGKTIEEI KQHYELLVED  60
INQIESGCVP LPSYNSSSEG STSHASDEGA GKKGSGPGHY SSESNHGTKA SRSDQERRKG  120
IAWTEDEHRL FLLGLDKYGK GDWRSISRNF VVTRTPTQVA SHAQKYFIRL NSMNKDRRRS  180
SIHDITSVIN GDISAPQGPI TGQTNGSAGN STAKAAKTDT PASTGVPGVG IYAAPTIGQP  240
IGGPLVSAVG TPVNLPAPAH MAYGVRAPVP GAVVPGAPVN MGPMTYPMPH TSAPHR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A2e-1812771176RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00500DAPTransfer from AT5G08520Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0984280.0BT098428.1 Soybean clone JCVI-FLGm-16J7 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003529238.10.0PREDICTED: transcription factor DIVARICATA-like
RefseqXP_006583758.10.0PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H73e-62DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0B2PU530.0A0A0B2PU53_GLYSO; Transcription factor MYB1R1
TrEMBLI1KKZ70.0I1KKZ7_SOYBN; Uncharacterized protein
STRINGGLYMA07G28310.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46943358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.11e-121MYB family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]